Protein Info for Echvi_1612 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TIGR01777 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF01370: Epimerase" amino acids 4 to 123 (120 residues), 49.9 bits, see alignment E=4.5e-17 TIGR01777: TIGR01777 family protein" amino acids 4 to 292 (289 residues), 303 bits, see alignment E=1.4e-94 PF08338: DUF1731" amino acids 249 to 295 (47 residues), 55.8 bits, see alignment 4.4e-19

Best Hits

Swiss-Prot: 38% identical to YFHF_BACSU: Epimerase family protein YfhF (yfhF) from Bacillus subtilis (strain 168)

KEGG orthology group: K07071, (no description) (inferred from 48% identity to mtt:Ftrac_2259)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX41 at UniProt or InterPro

Protein Sequence (298 amino acids)

>Echvi_1612 TIGR01777 family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNILITGGSGLIGQALTKALEAKGYAVAWLSRNPEKQTQKSFAWDIQKGHLDTQALEWA
DAIIHLAGAGVAEKRWTASRKKLILESRTQSTKLLFDQVRLLENKPSTFISASGANYYGL
DNGETWLNEESKMGDDFLSLVVEAWEKSAFQFEGLGIRTVAFRTGVVLSQKGGALPQMLQ
PPIAAPLGSGEQYMSWIHLTDLVEMYVYALEADNISGYYNAVAPQPVTNRELTRKAAAAK
GKPFVNIPVPGFLLKLVLGEMAEMILGGNKISCDKIISGGYSFRYSSLDHALKDLFGN