Protein Info for Echvi_1589 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 210 to 335 (126 residues), 86.7 bits, see alignment E=4.1e-28 PF12146: Hydrolase_4" amino acids 211 to 323 (113 residues), 43 bits, see alignment E=7.3e-15 PF12697: Abhydrolase_6" amino acids 211 to 413 (203 residues), 47.2 bits, see alignment E=8.9e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVC7 at UniProt or InterPro

Protein Sequence (424 amino acids)

>Echvi_1589 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Echinicola vietnamensis KMM 6221, DSM 17526)
MTKAIFAATVLLFLGIFQLTSAQQPYAGVVQSIDIQDYQGKKFTFTALTKYKSSNQMIGF
AAYYDDQGRFLANHLGDGPAPMEGREWQMLTLSGKINKKAAKLLVGVLCQGKGAFSLDDM
TLSIKGQPNDSLLLVNGNLEQHEVGVSAFISLNKDDSISITPSPLKKDNHILKLITNEES
TAIGSNKNAGKRVNANGVALYYETYGKGDPLLLLHGADMSIASFNRIIPILAKHYKVIAL
DTRGHGQSSEDGKKLTYELYAEDVNAFLDELGLEAVNVLGWSDGGNTGLILAMNHPDKVK
SLAAMAAVLYNDKSSVDPQVNKILSKQIKALENGALTDREAFSLRVKKSLLTEPNISPSS
LSKITCPALIMAGENDYVKEAHTKLIADHISDATLVTFKDTGHNAPLEIPKKFSEIVVNF
LKGN