Protein Info for Echvi_1580 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Choline dehydrogenase and related flavoproteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 PF00732: GMC_oxred_N" amino acids 187 to 327 (141 residues), 36.8 bits, see alignment E=5.5e-13 PF05199: GMC_oxred_C" amino acids 445 to 564 (120 residues), 77.3 bits, see alignment E=2.6e-25

Best Hits

KEGG orthology group: None (inferred from 69% identity to zpr:ZPR_3190)

Predicted SEED Role

"Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site" in subsystem Respiratory dehydrogenases 1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYX3 at UniProt or InterPro

Protein Sequence (580 amino acids)

>Echvi_1580 Choline dehydrogenase and related flavoproteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MSFQIKSSGEAYDVIIVGSGAGGGMASKILSEAGFSVAVVEAGADFDPAKEEDRTQLRPP
WESPRRGASTRNRPFGDFDAAIGGWDIEGEPYTFEGDTKFDWFRSRMVGGRTNHWGRISL
RFGPNDFKRKDIDGLGDNWPIGYDDLKPYYDKVDKLIGVFGSKEGIYNEPDGFFLPPPKP
RLHELYIKKGADKIGVPVIPSRLSILTKPINNERGACFFCNQCNRACQAYADFSSGTCLV
KPAMKKGKVDLYTYAMVRKVTTDDKGKATGVSYISKVDMKEYKLRSRVVVLGASACESAR
IMLNSKSKNHPDGLANGSGMIGHYLHDSTGSDRMGFIPGLLDRKKYNEDGVGGMHVYTPW
WEDNSKLDFARGYHIEYWGGMSMPGYGFGFGMETIRQHIKDEFGNPGTSGGYGEGLKKDI
RAYFGTMVGMSGRGESIPRYENYCEIDNNTVDKYGIPVLKFNYNWTDQEVNQAKHMHDTF
EEVLTNAGAVIYGNKPGPDTQYGLLTPGRIIHEVGTTRMGNNPKTSVLNSNCQAHECDNL
FVVDGGPFVSQADKNPTWTILALAWRTSDYIVSELKKKNI