Protein Info for Echvi_1569 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF02754: CCG" amino acids 3 to 84 (82 residues), 50.7 bits, see alignment E=7.9e-18 amino acids 121 to 216 (96 residues), 49.6 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 40% identical to LUTA_BACSK: Lactate utilization protein A (lutA) from Bacillus clausii (strain KSM-K16)

KEGG orthology group: None (inferred from 64% identity to phe:Phep_2946)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Fe-S oxidoreductase subunit YkgE" in subsystem Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVA8 at UniProt or InterPro

Protein Sequence (245 amino acids)

>Echvi_1569 Fe-S oxidoreductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRVGLFIPCYVDQFYPGAAQATLELLEKYGMDVVYPLSQTCCGQPMANSGYERYGKASSE
LFLENFGEFEYIVAPSGSCTLHVKDHVLPKTAEAPKIYELCEFLTDILKVDHVDASFPYK
VGFHSSCHGLRGLRLAKCSERMDEEFNKPLSLLSKVKGIEMVELDRKDECCGFGGTFAVA
EEAVSVTMGNDRIADHQRNGVEVLTGADMSCLMHMQGLLKRQKSPIKVMHIAEILNGNDV
MDREV