Protein Info for Echvi_1564 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Kef-type K+ transport systems, predicted NAD-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 23 to 40 (18 residues), see Phobius details amino acids 52 to 71 (20 residues), see Phobius details amino acids 82 to 112 (31 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details PF00520: Ion_trans" amino acids 23 to 238 (216 residues), 119.4 bits, see alignment E=1.5e-38 PF07885: Ion_trans_2" amino acids 155 to 230 (76 residues), 57.4 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: None (inferred from 55% identity to abo:ABO_1091)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVA4 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Echvi_1564 Kef-type K+ transport systems, predicted NAD-binding component (Echinicola vietnamensis KMM 6221, DSM 17526)
MDLTRKRLAHIVFESDDTASKRFDIVLLVAILGSVTIAILDSVQELHKEYGTVFYLLEWS
FTILFTMEYLLRVWLSRRTAGYVFSFYGLVDLLAILPTYLSLIVANSHFLAVVRALRFLR
VLRVLKLGRYLREAQVLTDALYNSRLKIQVFLGSVVTIVLVMGTVMFFIEGPESGFTSIP
TAMYWAIVTLTTVGYGDISPATPLGQFMASLIMLLGYAIIAVPTGIVTSEISASSKRRKQ
DERVCHTCHASGHDDDAYHCKYCGTRL