Protein Info for Echvi_1561 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Hemolysins and related proteins containing CBS domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 6 to 33 (28 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 88 to 107 (20 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details PF01595: CNNM" amino acids 9 to 178 (170 residues), 116.1 bits, see alignment E=1.5e-37 PF00571: CBS" amino acids 263 to 313 (51 residues), 32.2 bits, see alignment 1.1e-11

Best Hits

KEGG orthology group: None (inferred from 51% identity to sru:SRU_0924)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYI6 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Echvi_1561 Hemolysins and related proteins containing CBS domains (Echinicola vietnamensis KMM 6221, DSM 17526)
MVLLILYLTLAIGVSFLCSMLEAALLSITPSYIATQQEKGKAYAKQLMRLKENINQPLAA
ILSFNTIAHTVGAAGVGAQAVEVFGQQYFGYISAGLTIAILVFSEIIPKSIGANYWKQMA
PFIGGILKVMIYGLYPLVKVSEYLTQFFKSAEEHTTSREELAAMTTIATKEGVFREDESK
IIQNLIRFRSILVANVMTPRTVTVAMEESETVKDFYAKSDSKRFSRFPIYHKTIDNISGY
IMKHDVLAAMAEDQFEKKLVELKREITIVYEHYPIPTVLETMLNKREHVALVVDKYGGMS
GIVTMEDILETLLGMEIQDESDEERDMQVLARNKWAERAKKMGLIFDNPGENID