Protein Info for Echvi_1519 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Na+/H+-dicarboxylate symporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 161 to 178 (18 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 334 to 340 (7 residues), see Phobius details amino acids 349 to 369 (21 residues), see Phobius details amino acids 374 to 396 (23 residues), see Phobius details PF00375: SDF" amino acids 7 to 422 (416 residues), 429.5 bits, see alignment E=6.2e-133

Best Hits

KEGG orthology group: None (inferred from 56% identity to aas:Aasi_1194)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV54 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Echvi_1519 Na+/H+-dicarboxylate symporters (Echinicola vietnamensis KMM 6221, DSM 17526)
MLKKIPLHTQIIIGLVLGLVFGLIVIKTQMSPDFTMDYIKPIGTIFINGLKMIAVPLVLA
SLIVGVSNLGDITKLGRIGGKTIGAYMMTTVIAVTVGLLLVNVFAPGKSLPIETRERLME
QFDDVVGDKSSQAAELKEQTPLKPLVDMVPENVFLAAADNGSMLQVVFFAIIVGIALLEI
PKSKASPVIAFFDGLNDVIIKIVGYIMLIAPYGVFALMASLIVEIAGDNPDSAIELLFAL
LKYSLLVVAGLLLMIVLVYPTILKLFTKVKYKDFFAALRPAQLLAFSTSSSSATLPVTMK
QVEEEIGVSEEVSSFVLPLGATINMDGTCLYQGVAAVFIAQALGLDLSLTQQLMIVLTAT
LASIGTAGVPGAGLIMLLIVLESIGVPSAGLALILAPDRILDMFRTVVNVTGDATVCTVV
ASTEGELPDGLIRESNPLTTTSDA