Protein Info for Echvi_1506 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF02542: YgbB" amino acids 4 to 157 (154 residues), 220.8 bits, see alignment E=5.5e-70 TIGR00151: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase" amino acids 5 to 159 (155 residues), 202.7 bits, see alignment E=1.7e-64

Best Hits

Swiss-Prot: 68% identical to ISPF_PORGI: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF) from Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

KEGG orthology group: K01770, 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [EC: 4.6.1.12] (inferred from 72% identity to dfe:Dfer_2948)

MetaCyc: 48% identical to 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Escherichia coli K-12 substr. MG1655)
2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase. [EC: 4.6.1.12]

Predicted SEED Role

"2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (EC 4.6.1.12)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 4.6.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYD1 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Echvi_1506 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKFRIGFGYDVHQLKEGYDFWLGGIKLEHSKGAVGHSDADVLIHVICDALLGAANLRDI
GYHYSDQDPEYKGIDSKLLLADVLKMIRENGYEIGNLDTTICLQLPKVNPHIDTMKTCLA
EVMAIAEEDISIKATTTEKLGFVGRQEGVSAYCVALIYKND