Protein Info for Echvi_1502 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details PF03073: TspO_MBR" amino acids 23 to 163 (141 residues), 171.7 bits, see alignment E=4.2e-55

Best Hits

KEGG orthology group: K07185, tryptophan-rich sensory protein (inferred from 49% identity to phe:Phep_1272)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWS9 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Echvi_1502 Tryptophan-rich sensory protein (mitochondrial benzodiazepine receptor homolog) (Echinicola vietnamensis KMM 6221, DSM 17526)
MDTKGKASGKKINWLHLLGFMFGVMVIGSLAGIANAGNITTWYATLEKPPFNPPNSLFGP
VWTVLYALMGVGIYLVWKSPDSPQRKKAIQVFIVQLVLNFCWSFIFFYFHLIGWAAIEIV
LLLGMIIWMILIFRRVDKLAAYLQLPYLLWVSFATLLNVSIWWLNR