Protein Info for Echvi_1481 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 159 to 180 (22 residues), see Phobius details PF00487: FA_desaturase" amino acids 42 to 141 (100 residues), 40.5 bits, see alignment E=1.5e-14 amino acids 123 to 226 (104 residues), 39.8 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: None (inferred from 46% identity to mxa:MXAN_6049)

MetaCyc: 67% identical to myxocoxanthin ketolase (Algoriphagus sp. KK10202C)
RXN-19179 [EC: 1.14.99.63]

Predicted SEED Role

"Beta-carotene ketolase (EC 1.14.-.-)" in subsystem Carotenoids (EC 1.14.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.- or 1.14.99.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWR2 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Echvi_1481 Fatty acid desaturase (Echinicola vietnamensis KMM 6221, DSM 17526)
MARPKAPYRPIDPTGPLIALLIIGLWGVSLVFLLQWEMELSNPLVYLAILIQMHLYTGLF
ITAHDAMHGSVSKNADLNRAIGWTAAILFSYNFYHRLLPKHYLHHRFVATDEDPDYHASD
DFWRWYWRFMTTYLNPLQLVLMGLTYWILQLFLPMENLILFWILPAILSTFQLFYFGTYL
PHRGEHHNKHKSSTQSKNHFWAFLSCYFFGYHFEHHDAPGTPWWQLWRMK