Protein Info for Echvi_1471 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 4-hydroxybenzoate polyprenyltransferase and related prenyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 106 to 134 (29 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 219 to 237 (19 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF01040: UbiA" amino acids 50 to 272 (223 residues), 125.3 bits, see alignment E=1.3e-40

Best Hits

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 50% identity to mtt:Ftrac_2481)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWQ4 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Echvi_1471 4-hydroxybenzoate polyprenyltransferase and related prenyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNHSPSAEKAFSFTAFLRIIRTDNLLMMAFAQLMTAYFLVEETQTGTPALLDPKIYLLIT
STILIAASGYLINDYYDVKIDYINKPDEVVIGKGMRRRVVMFLHTFFNLVGIGLACLVSL
KVGAIHFIAAILLWMYSNSLKRLPFVGNLAVALLTALAIWIVGFYYQQSALVVLAYAIFA
FFINLIREIIKDIEDREGDRKHGCKTLPVVLGFRATKNIIFIIATVFVTSIIVVAYKIDQ
PLLYLYFGLIGLLFLYFMYLIYQADRKSHFTRLSKLSKILMLTGVMSMAFL