Protein Info for Echvi_1467 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: rod shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 65 to 261 (197 residues), 94.9 bits, see alignment E=2.5e-31 PF04085: MreC" amino acids 110 to 258 (149 residues), 142 bits, see alignment E=6.1e-46

Best Hits

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 40% identity to mtt:Ftrac_2255)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXF7 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Echvi_1467 rod shape-determining protein MreC (Echinicola vietnamensis KMM 6221, DSM 17526)
MQRILLFLYSIRAFLLFVTLETVAIWLIVSYNSPQGAVFFNSSNSFTGAFLSTKDNFTEY
FTLGRSNEELAKKNALLMKQLANLSPVKDSVNIPLDSLMESTYDFRSAKVINNSINLRNN
HITLNRGAEDGIKEGMGVFNGDGIVGRVKGVSRHYASVISLLHTDLLVSSKIRATDVFGS
TQWDGKNPQKAKLKYVPRHVQVAHGDTVVTSGYNAVFPEGILVGTVDSVSNGTDTNYLDI
TIDLAANFSTLTYVYLVENNREAELDSLQEITEIVNE