Protein Info for Echvi_1413 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transposase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 PF01527: HTH_Tnp_1" amino acids 2 to 70 (69 residues), 72.7 bits, see alignment E=4.8e-24 PF13384: HTH_23" amino acids 18 to 49 (32 residues), 28.4 bits, see alignment E=2.3e-10 PF13518: HTH_28" amino acids 20 to 45 (26 residues), 29.8 bits, see alignment E=9.8e-11

Best Hits

Swiss-Prot: 49% identical to LCRS_YERPS: Low calcium response locus protein S (lcrS) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: None (inferred from 59% identity to dap:Dacet_1482)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FYG5 at UniProt or InterPro

Protein Sequence (88 amino acids)

>Echvi_1413 Transposase. (Echinicola vietnamensis KMM 6221, DSM 17526)
MKRSNFSEAQIIKILGSQEAGRSVSEICREHGISQGTFYNWKSKYSGMDLSQLKQMKEME
KELAQYKKIVAELTLQNTVLKDVIEKKL