Protein Info for Echvi_1399 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Site-specific recombinases, DNA invertase Pin homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF00239: Resolvase" amino acids 4 to 154 (151 residues), 86.2 bits, see alignment E=3.7e-28 PF07508: Recombinase" amino acids 180 to 265 (86 residues), 37.1 bits, see alignment E=4.8e-13 PF13408: Zn_ribbon_recom" amino acids 281 to 340 (60 residues), 32.4 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: None (inferred from 54% identity to lby:Lbys_0554)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWI6 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Echvi_1399 Site-specific recombinases, DNA invertase Pin homologs (Echinicola vietnamensis KMM 6221, DSM 17526)
MESAYLYIRVSTDEQKRKGYSLPEQEERLLQYCGFHNITVMGIYREDFSAKSFNRPEWKK
LIAAIKGNKGRKPENILFVKWDRFSRNIQYAYEMIGILRNLNTQAVAIDQPIDFDIPESS
VMLAVYLSIPEAENNRRALNTSNGMRRAKQAGRYPGKAPLGYINQISPDGKKFIAPKHPE
ADIIIWSFQQLAKRSFTIEEVRRMACTKGLKCGKSNFWKLIRNPAYCGIVTVPPRGSEEM
EFVKALHKPLISEELFNEVQASIKRKTRPRGKTEELKKIFPLRGYLTCPLCGRKLTGSVS
KGSSNSYPYYHCLGGKCKARFNADRINSLYNEKLEKLVLKQGVIELFKLILKEVNASVQQ
SEYLRERRLLLDKIDEREILMSKARKLYINDKIEFEDFSELKKEYNLASEGLKNDLNRIN
ARLQLYDKYNYMEDESYSDIFSRYRDFDIGDQRKIINGIMPGNINTKTRDLDSLVLNNTL
SKILTIANNQSAALSAQP