Protein Info for Echvi_1357 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Bacteroides conjugative transposon TraK protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details TIGR03781: Bacteroides conjugative transposon TraK protein" amino acids 5 to 205 (201 residues), 232.2 bits, see alignment E=2.2e-73

Best Hits

KEGG orthology group: None (inferred from 61% identity to zpr:ZPR_3463)

Predicted SEED Role

"Conjugative transposon protein TraK" in subsystem Conjugative transposon, Bacteroidales

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FY00 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Echvi_1357 Bacteroides conjugative transposon TraK protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MFKNLQNIDTAFKHIRLFAFGIMAGSILIAGFISFKAFRMVQSTQERIYILAEGKALEAF
AAQRRDNIPVEARDHVKMFHHYFFTLSPDDRHIKEQVGKSLYMADGSAKAAYDNLRESGY
YTRMVSANINQTIHMDSIAIDTDFHPYRFTYYGTQRIIRPTSVVTRRLVTEGRLRHVDRS
DRNPHGFLIERWETLSNENLNVEKR