Protein Info for Echvi_1332 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 26 to 586 (561 residues), 526.5 bits, see alignment E=3.2e-162 PF01368: DHH" amino acids 80 to 228 (149 residues), 97.4 bits, see alignment E=1.2e-31 PF02272: DHHA1" amino acids 375 to 464 (90 residues), 57.3 bits, see alignment E=2.8e-19 PF17768: RecJ_OB" amino acids 479 to 585 (107 residues), 93.8 bits, see alignment E=1e-30

Best Hits

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX52 at UniProt or InterPro

Protein Sequence (589 amino acids)

>Echvi_1332 single-stranded-DNA-specific exonuclease RecJ (Echinicola vietnamensis KMM 6221, DSM 17526)
MEFRWEIKSKADQSTVQSLSSEINVNPTLANLLANRKVTSFQEAKDFFRPDLDKIHSPFL
MKDMDKAVDRLVQAIEQEEKILVYGDYDVDGTTAVALFYGFLSSVYPHVDFYIPDRYQEG
YGVSERGVRYAAENGFRLIVSLDCGIKAIEKVALANSLGVDFIICDHHTPGDELPHALAV
LDPKRKDCTYPYKELSGCGVGFKLIQAFTEKTGKNASHLFGLLDLVAVSIAADIVPITGE
NRILAHYGLERLNNNPRPGLMALILAGKGQRSLQELLENRQLLQREMLQLKSDKDIDISD
IVFRIGPRINASGRLEHAKASVELLISQDIHDALRRAEVVEDVNAARKNFDENITKEAIQ
MIEDREQDKPYKSTVLYKEDWHKGVIGIVASRCIEQYYRPTIILTESNNKATGSARSVYD
FDIYEAISECSDLLEQFGGHKYAAGLTMELDKVPAFQARFEEVVTRRIADIHTKPVLEVD
DELELDQINYKFYNILRQMAPFGPGNTEPIFCANQVYAQNIKVLKDKHLKFEIVQDGQVT
SPVCIAFGFATYYEMLRSKMRFNIAFEVRENTFRNTSSLQLYVKDIKFD