Protein Info for Echvi_1204 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00126: HTH_1" amino acids 5 to 62 (58 residues), 73.1 bits, see alignment E=2.2e-24 PF03466: LysR_substrate" amino acids 88 to 290 (203 residues), 141.1 bits, see alignment E=4.8e-45 PF12849: PBP_like_2" amino acids 90 to 254 (165 residues), 37.1 bits, see alignment E=4.8e-13

Best Hits

KEGG orthology group: None (inferred from 59% identity to ppn:Palpr_0027)

Predicted SEED Role

"LysR family transcriptional regulator YeiE" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXU9 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Echvi_1204 Transcriptional regulator (Echinicola vietnamensis KMM 6221, DSM 17526)
MFDFRLQVFHTVAKRLNFTKAAEELYISQPAVTKHIRQIELHYQVKLFDRQGSKISLTPA
GETLFEHAEQIFAIYRDLEFELNHFTKDHRGELRIGASTTIAQYVLPPILAAFHEKFSDI
RLSLSTDNTEQIGKALDQGEIDLGIIEGQTKQSQFKYTEFTKDEILLIARADHPLAKKES
LSIPELLKIPLLLREPGSGTLEVIAHALKPLGVKLGQLQKEMQLGSTESIKGYLMNSNAM
AFLSVFTVLEELHSKKFTVIDIDQLSIERSFLFIQPHGAKEGIADLFMKFAHRHNFR