Protein Info for Echvi_1202 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 230 to 254 (25 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 351 to 377 (27 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 421 to 443 (23 residues), see Phobius details amino acids 458 to 475 (18 residues), see Phobius details amino acids 495 to 514 (20 residues), see Phobius details PF11412: DsbD_N" amino acids 42 to 154 (113 residues), 41.3 bits, see alignment E=2.9e-14 PF02683: DsbD_TM" amino acids 234 to 442 (209 residues), 102.1 bits, see alignment E=5.5e-33 PF13899: Thioredoxin_7" amino acids 572 to 632 (61 residues), 50.8 bits, see alignment 3e-17 PF13098: Thioredoxin_2" amino acids 574 to 701 (128 residues), 44.2 bits, see alignment E=4.6e-15

Best Hits

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWQ8 at UniProt or InterPro

Protein Sequence (709 amino acids)

>Echvi_1202 Thiol:disulfide interchange protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MKSLKKSLPFVFLFCLTSWVAFAQLIEPPKWQMTLSDPTPFVDDEVELIFKADIPREWYI
YSNDFDPDLGPMLTELSLEGSEGIEPVGELKPINPKRKMDEIWDGEVSYFTGTAEFRQKV
KITKTAVKIVGLISYQMCSDVTGQCVPYEEDFSQSVNASIKKEAVPDTDEVEENNAPSAA
DTSSPASETADADTSGDVKPEVTTTPEKTGTKVPEVDLSPEGKQGDATSMWPFVIAAFLG
GLAALLTPCVFPMIPMTVTFFTGRSKSRAQGIRNAFIYGLSIIVIYTLAGTIVAAVQGPE
FANWLSTHWLPNIFFFLVFVFFALAFLGLFEITLPSGLVNKMDAKADKGGLTGVFFMAFT
LVLVSFSCTGPIVGSILIESAGGEILKPIMGMFAFSLAFAIPFTLFAIFPEWLNGLPKSG
GWLNSVKVVLGFLELALAFKFLSVADQVYHWGLLDRDIYIAIWIVIFALMGLYLLGKIRL
PHDSPIEKLSVPRLLLATVTFIFVVYLVPGLFGAPLKSLSGYLPPIHTHDFNIEKLIREN
RGGGATAQQEMTEVPKHGELLHWPHGLQGYYDYEQALRVAKKENKPLFIDFTGHGCVNCR
EMEAKVWSQPEVLERLKQDFVLVALYVDERTELPEEDWYTSAYDDKVKKTIGKQNADFQI
TRFNNNAQPYYVILDHDEEMLVRPKAYDTDPQNFVEFLDKAKEAFDEGA