Protein Info for Echvi_1196 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: triosephosphate isomerase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 64% identical to TPIS_CYTH3: Triosephosphate isomerase (tpiA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)
KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 66% identity to mtt:Ftrac_2600)MetaCyc: 42% identical to triosephosphate isomerase (Mycoplasmoides pneumoniae M129)
Triose-phosphate isomerase. [EC: 5.3.1.1]
Predicted SEED Role
"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)
MetaCyc Pathways
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- glycolysis III (from glucose) (10/11 steps found)
- Calvin-Benson-Bassham cycle (11/13 steps found)
- gluconeogenesis I (11/13 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- homolactic fermentation (10/12 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis IV (8/10 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
- glycerol degradation to butanol (12/16 steps found)
- gluconeogenesis III (9/12 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
- ethene biosynthesis V (engineered) (18/25 steps found)
- superpathway of anaerobic sucrose degradation (13/19 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- superpathway of hexitol degradation (bacteria) (12/18 steps found)
- glycolysis V (Pyrococcus) (6/10 steps found)
- oxygenic photosynthesis (11/17 steps found)
- sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
- superpathway of N-acetylneuraminate degradation (13/22 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)
KEGG Metabolic Maps
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Inositol phosphate metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 5.3.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FVY6 at UniProt or InterPro
Protein Sequence (253 amino acids)
>Echvi_1196 triosephosphate isomerase (Echinicola vietnamensis KMM 6221, DSM 17526) MRKKIVAGNWKMNGTQEEGQKLTSEIVNMVKDERISDVTVVLNPPFVHASNVKKLIGGVD NIFLGGQNCSDKASGAYTGETSASILASFGATYVIIGHSERREYFAESNEQLTEKVKLAL ENGLTPIFCCGEPLEIREAGTHEAYVKDQLTESLFGLSEEDFAKIVIAYEPIWAIGTGKT ASSDQAQEMHAAIRAHLASKYGEKIAEGTSILYGGSCKPDNAPEIFSKPDVDGGLIGGAS LKSRDFVDIIKSF