Protein Info for Echvi_1196 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: triosephosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF00121: TIM" amino acids 4 to 252 (249 residues), 318.3 bits, see alignment E=1.8e-99 TIGR00419: triose-phosphate isomerase" amino acids 5 to 243 (239 residues), 192.2 bits, see alignment E=5.8e-61

Best Hits

Swiss-Prot: 64% identical to TPIS_CYTH3: Triosephosphate isomerase (tpiA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 66% identity to mtt:Ftrac_2600)

MetaCyc: 42% identical to triosephosphate isomerase (Mycoplasmoides pneumoniae M129)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVY6 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Echvi_1196 triosephosphate isomerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRKKIVAGNWKMNGTQEEGQKLTSEIVNMVKDERISDVTVVLNPPFVHASNVKKLIGGVD
NIFLGGQNCSDKASGAYTGETSASILASFGATYVIIGHSERREYFAESNEQLTEKVKLAL
ENGLTPIFCCGEPLEIREAGTHEAYVKDQLTESLFGLSEEDFAKIVIAYEPIWAIGTGKT
ASSDQAQEMHAAIRAHLASKYGEKIAEGTSILYGGSCKPDNAPEIFSKPDVDGGLIGGAS
LKSRDFVDIIKSF