Protein Info for Echvi_1187 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Twin arginine targeting (Tat) protein translocase TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 18 to 257 (240 residues), 162.9 bits, see alignment E=5.3e-52 PF00902: TatC" amino acids 19 to 252 (234 residues), 211.8 bits, see alignment E=5.1e-67

Best Hits

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 61% identity to mtt:Ftrac_3133)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWP0 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Echvi_1187 Twin arginine targeting (Tat) protein translocase TatC (Echinicola vietnamensis KMM 6221, DSM 17526)
MALDQYREEEEEDGMSFLDHLEQLRWHLVRSVAAVLIFSVLAFLSKSFVFGQVILGPSKV
DFFTYRMLCKVSDALNIPALCIQELPFILQSRQMTGQFSMHMTSSLVVGLIVAFPYVFWE
VWRFISPGLYSRERKAARGAVFFVSLLFFMGAAFGYYILSPLSINFLSHYRLDPSIANEF
DITSYISTLVMLVLASAVMFQLPVVIYFLSMSGLVNSAMLKSYRRHAVVIILVLSAVITP
PDVISQLLIAMPILILYEAGIIIAKRLERRRREERAAEEDY