Protein Info for Echvi_1158 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: nicotinate-nucleotide pyrophosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 15 to 283 (269 residues), 313.7 bits, see alignment E=4.6e-98 PF02749: QRPTase_N" amino acids 27 to 112 (86 residues), 69.2 bits, see alignment E=3e-23 PF01729: QRPTase_C" amino acids 114 to 283 (170 residues), 197.2 bits, see alignment E=1.8e-62

Best Hits

Swiss-Prot: 49% identical to NADC_ARATH: Nicotinate-nucleotide pyrophosphorylase [carboxylating], chloroplastic (QPT) from Arabidopsis thaliana

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 68% identity to mtt:Ftrac_2356)

MetaCyc: 49% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Nicotiana rustica)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FU50 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Echvi_1158 nicotinate-nucleotide pyrophosphorylase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKENYLTRENLEAFIQAAFKEDVGEGDHSTLAAIPKDKEGSAQLFIKEDGIIAGLELAEL
IFHSYDKELEVQLLMEDGQEVSKGAIGLKVKGKAASILTTERLVLNCMQRMSGIATKTHN
LTKLISHTHAKLLDTRKTTPNFRMLEKWAVAIGGGENHRFALYDMVMLKDNHIDFAGGIE
AAILATKAYLKENLLDLKIEVETRNLEEVKEVLRVGGVDVIMLDNMSYDMMKEAVAFIDG
KMLTEASGGITEETLKDVAECGVDYISVGALTHHVKSMDISLKAD