Protein Info for Echvi_1144 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glutamate decarboxylase and related PLP-dependent proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF00282: Pyridoxal_deC" amino acids 92 to 337 (246 residues), 100.4 bits, see alignment E=9.4e-33 PF00155: Aminotran_1_2" amino acids 137 to 241 (105 residues), 20.6 bits, see alignment E=2.4e-08

Best Hits

Swiss-Prot: 51% identical to TRPDC_CLOS1: Tryptophan decarboxylase (CLOSPO_02083) from Clostridium sporogenes (strain ATCC 15579)

KEGG orthology group: None (inferred from 48% identity to mtt:Ftrac_2647)

Predicted SEED Role

"L-tyrosine decarboxylase (EC 4.1.1.25)" (EC 4.1.1.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FXN1 at UniProt or InterPro

Protein Sequence (416 amino acids)

>Echvi_1144 Glutamate decarboxylase and related PLP-dependent proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MFWKKLSHEEVKKQIFGALAQNHNYRGEYPALGVPGTYLDTTEFYHDAPFLKDAPFMSVM
VQNPNHIGIHTLSEESVLDLFQGTQKIERDLINLVAEEVFAGEQGQQDGYVATGGTEANI
QAMWVYRNFFQAEYGAKTEEIAVVYSSDSHYSMPKGANLLNLHNIILEVDEETRQITQAS
LESKITEAKENGVKYFIVIANLSTTMFGSVDDVDRLGDFFTTANVTFRIHVDAAYGGFIY
PFTNEESTYTFQNPYITSFTSDGHKMLQTPYGTGLFLIRKGYIHHVCTEEAQYIPGKDYT
LCGSRSGANAVSMWMILKIHGSEGWKYKMASLCDRTERICTRLDRMGVKYFRNPHLNIIT
IKSEFISPRIAKKYNLVADSYEFKPKWYKIVVMHHVRQGVLDSFLMDLEGELVSKG