Protein Info for Echvi_1122 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF00072: Response_reg" amino acids 4 to 115 (112 residues), 95.8 bits, see alignment E=1.8e-31 PF00196: GerE" amino acids 149 to 201 (53 residues), 59.6 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: None (inferred from 46% identity to mtt:Ftrac_1349)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWH1 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Echvi_1122 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain (Echinicola vietnamensis KMM 6221, DSM 17526)
MIRVVLADDHKMFAKGIANLLEKEEDIQVMGVFTNGKELVEFLKKEQVDLVLTDMNMPGM
DGLAVIQQINKEKIKARLIVLSMYDDEDIFKKCQKQGVDGYVLKDADPDELIYTIREVIN
GHHVMHFQRVLKQVDEDQYYDAFKQKFKLSRRELQILSLIKDGHTNQSIADELFLSIYTV
ETHRKNIHHKLGVNTVVELMKKALEMNL