Protein Info for Echvi_1101 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: N-acetylglutamate synthase and related acetyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13420: Acetyltransf_4" amino acids 8 to 142 (135 residues), 37.2 bits, see alignment E=7.8e-13 PF13673: Acetyltransf_10" amino acids 31 to 155 (125 residues), 120.1 bits, see alignment E=1.5e-38 PF00583: Acetyltransf_1" amino acids 32 to 134 (103 residues), 58.8 bits, see alignment E=1.6e-19 PF13508: Acetyltransf_7" amino acids 60 to 135 (76 residues), 54.5 bits, see alignment E=3.1e-18 PF08445: FR47" amino acids 78 to 140 (63 residues), 25.2 bits, see alignment E=3.2e-09

Best Hits

KEGG orthology group: K03830, putative acetyltransferase [EC: 2.3.1.-] (inferred from 46% identity to dfe:Dfer_1874)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVN7 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Echvi_1101 N-acetylglutamate synthase and related acetyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNAYDIIIRQAELNDMIKVQQLYVETIQNSCKNDYSEEQIAAWISSVINEARWQQALKEE
FFLVAEYDEKIVGFGALKDDNYIDFMYIQHEYQRLGLAERLLKALEHQAKKNHSAEIIAD
ASKTAVPFFEKMGFRMVQENTKVVNGLELVNYRVEKAFLE