Protein Info for Echvi_1094 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Acetyltransferases, including N-acetylases of ribosomal proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 16 to 155 (140 residues), 66.7 bits, E=3.8e-22
• PF00583: Acetyltransf_1
  • amino acids 42 to 153 (112 residues), 24.7 bits, E=2.5e-09

Best Hits

KEGG orthology group: None (inferred from 58% identity to sdn:Sden_1154)

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

See L0FXH8 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Echvi_1094 Acetyltransferases, including N-acetylases of ribosomal proteins (Echinicola vietnamensis KMM 6221, DSM 17526)
MENHWLTPLTLKGEKVTLVPLQQAHRDGLIEAAADGKLWELWYTSVPSPETMDQYIEQAL
QQQAASTSLPFVIIDNASEKVVGCTRYCNAEAKHKRLEIGFTWYAKSVQRTGLNRECKYL
LLQHAFEKLDFICVQFKTDWFNLPSRNAIAKLGAKQDGILRNDRLNADGTYRDTVVFSII
QQEWHGVKKNLSYRMNHFIG