Protein Info for Echvi_1073 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Acyl-CoA dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 PF02771: Acyl-CoA_dh_N" amino acids 30 to 143 (114 residues), 111.1 bits, see alignment E=1.2e-35 PF02770: Acyl-CoA_dh_M" amino acids 147 to 241 (95 residues), 89.8 bits, see alignment E=3.1e-29 PF00441: Acyl-CoA_dh_1" amino acids 254 to 416 (163 residues), 119 bits, see alignment E=6.5e-38 PF08028: Acyl-CoA_dh_2" amino acids 271 to 409 (139 residues), 45.9 bits, see alignment E=2.1e-15 PF21263: Acyl-CoA-dh_C" amino acids 466 to 569 (104 residues), 118 bits, see alignment E=5.5e-38

Best Hits

KEGG orthology group: None (inferred from 67% identity to mtt:Ftrac_1683)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.8.1)" (EC 1.3.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTV9 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Echvi_1073 Acyl-CoA dehydrogenases (Echinicola vietnamensis KMM 6221, DSM 17526)
MTTKNNTINGGEFLIRETAATEIFIPAEFTEEQRMMAQACQDFIDTEILPKSEEIDSMKN
PDLVPAILKKAGELGLLGISVPEEYQGLGMSFNTSMLIADIIGAAGSFSTTYGAHTGIGT
LPILYYGTEEQKKKYLPKLATGEWAACYCLTEPDAGSDANSGKTKATLTEDGKHYLLNGQ
KMWISNGGFADLFIVFAKIGEDKNLTAFIVEKDFGGITMNEEEKKMGIKGSSTRQVFFND
CKVPVENMLSDRQNGFKIAVNILNIGRVKLGAGVLGGCRQVIKNALQYSSERKQFGVSIN
TFGAIKSKLAEMAVKTYVSESLCYRLGQNIEDRIDALMASGMEANQAKLKGVEQFAMECA
IAKIHGSEVLDYVVDQGVQIYGGMGYSADAPMERAYRDARISRIYEGTNEINRMLMIGML
LKRAMKGEVDLFGPAKAVADELTAVPSFGAVDNSQLFAAEKELLKKLKKVFLMIGGKAAM
TFGPKIEEEQEIMMNLADIMIEIYAAESALLRTEKRVTLQGEEACKQQIAMVKVYLTEAV
DIIQAAGKEAIASFTTGDEQKVMLMGLKRFTKADPENTKALRRQIADHMIDKGKYPYFN