Protein Info for Echvi_1072 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: S23 ribosomal protein.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 PF05635: 23S_rRNA_IVP" amino acids 5 to 108 (104 residues), 129 bits, see alignment E=4.1e-42 TIGR02436: four helix bundle protein" amino acids 9 to 116 (108 residues), 125.9 bits, see alignment E=3.9e-41

Best Hits

KEGG orthology group: None (inferred from 50% identity to gfo:GFO_1046)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWC2 at UniProt or InterPro

Protein Sequence (116 amino acids)

>Echvi_1072 S23 ribosomal protein. (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNYKELKVWKRGIFLAKDIYVLTATFPHDEKYGLVTQMRRSAVSVASNIAEGAGRGSDR
EFRRFMDIAYGSLCELDTQLCIAKLLDLVNDSVFKSLENEINEMQKMSYSLIKSLK