Protein Info for Echvi_1071 in Echinicola vietnamensis KMM 6221, DSM 17526
Annotation: acetyl-CoA acetyltransferases
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to FADA_BACSU: 3-ketoacyl-CoA thiolase (fadA) from Bacillus subtilis (strain 168)
KEGG orthology group: K00632, acetyl-CoA acyltransferase [EC: 2.3.1.16] (inferred from 71% identity to mtt:Ftrac_1684)Predicted SEED Role
"3-ketoacyl-CoA thiolase (EC 2.3.1.16) @ Acetyl-CoA acetyltransferase (EC 2.3.1.9)" (EC 2.3.1.16, EC 2.3.1.9)
MetaCyc Pathways
- oleate β-oxidation (27/35 steps found)
- benzoyl-CoA biosynthesis (3/3 steps found)
- ketolysis (3/3 steps found)
- fatty acid salvage (5/6 steps found)
- pyruvate fermentation to butanol II (engineered) (5/6 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
- glycerol degradation to butanol (12/16 steps found)
- fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
- pyruvate fermentation to butanol I (6/8 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (10/14 steps found)
- L-isoleucine degradation I (4/6 steps found)
- acetoacetate degradation (to acetyl CoA) (1/2 steps found)
- valproate β-oxidation (6/9 steps found)
- glutaryl-CoA degradation (3/5 steps found)
- ketogenesis (3/5 steps found)
- (2S)-ethylmalonyl-CoA biosynthesis (2/4 steps found)
- pyruvate fermentation to hexanol (engineered) (7/11 steps found)
- fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
- pyruvate fermentation to butanoate (4/7 steps found)
- 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
- polyhydroxybutanoate biosynthesis (1/3 steps found)
- 5,6-dehydrokavain biosynthesis (engineered) (6/10 steps found)
- propanoate fermentation to 2-methylbutanoate (3/6 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (2/5 steps found)
- 4-hydroxybenzoate biosynthesis III (plants) (2/5 steps found)
- ethylbenzene degradation (anaerobic) (2/5 steps found)
- fatty acid β-oxidation VII (yeast peroxisome) (2/5 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
- acetyl-CoA fermentation to butanoate (3/7 steps found)
- fatty acid β-oxidation I (generic) (3/7 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (5/10 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (4/9 steps found)
- isopropanol biosynthesis (engineered) (1/5 steps found)
- pyruvate fermentation to acetone (1/5 steps found)
- (8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (10/18 steps found)
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (4/10 steps found)
- 10-trans-heptadecenoyl-CoA degradation (MFE-dependent, yeast) (1/6 steps found)
- 4-ethylphenol degradation (anaerobic) (1/6 steps found)
- benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
- 2-deoxy-D-ribose degradation II (2/8 steps found)
- 2-methylpropene degradation (2/8 steps found)
- L-tryptophan degradation III (eukaryotic) (7/15 steps found)
- mevalonate pathway I (eukaryotes and bacteria) (1/7 steps found)
- mevalonate pathway II (haloarchaea) (1/7 steps found)
- 3-phenylpropanoate degradation (3/10 steps found)
- L-glutamate degradation VII (to butanoate) (4/12 steps found)
- isoprene biosynthesis II (engineered) (1/8 steps found)
- mevalonate pathway III (Thermoplasma) (1/8 steps found)
- mevalonate pathway IV (archaea) (1/8 steps found)
- ethylmalonyl-CoA pathway (3/11 steps found)
- 9-cis, 11-trans-octadecadienoyl-CoA degradation (isomerase-dependent, yeast) (2/10 steps found)
- L-lysine fermentation to acetate and butanoate (2/10 steps found)
- methyl tert-butyl ether degradation (2/10 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
- 4-oxopentanoate degradation (1/9 steps found)
- (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
- docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
- 10-cis-heptadecenoyl-CoA degradation (yeast) (1/12 steps found)
- 10-trans-heptadecenoyl-CoA degradation (reductase-dependent, yeast) (1/12 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (3/16 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (3/17 steps found)
- jasmonic acid biosynthesis (4/19 steps found)
- toluene degradation VI (anaerobic) (3/18 steps found)
- cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
- sitosterol degradation to androstenedione (1/18 steps found)
- androstenedione degradation I (aerobic) (6/25 steps found)
- platensimycin biosynthesis (6/26 steps found)
- cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (2/22 steps found)
- superpathway of testosterone and androsterone degradation (6/28 steps found)
- androstenedione degradation II (anaerobic) (4/27 steps found)
- superpathway of ergosterol biosynthesis I (3/26 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)
- superpathway of L-lysine degradation (9/43 steps found)
- superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
- superpathway of cholesterol biosynthesis (3/38 steps found)
- superpathway of cholesterol degradation II (cholesterol dehydrogenase) (8/47 steps found)
- superpathway of cholesterol degradation III (oxidase) (4/49 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Ethylbenzene degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Lysine degradation
- Propanoate metabolism
- Pyruvate metabolism
- Synthesis and degradation of ketone bodies
- Terpenoid biosynthesis
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.16, 2.3.1.9
Use Curated BLAST to search for 2.3.1.16 or 2.3.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0FVK6 at UniProt or InterPro
Protein Sequence (391 amino acids)
>Echvi_1071 acetyl-CoA acetyltransferases (Echinicola vietnamensis KMM 6221, DSM 17526) MDAYIIKGYRTAVGKAKKGGFRFYRPDDLAVDVIKKLIADTPGLEAERVDDLIVGNAVPE AEQGMQMGRMISLMALGKVVPGFIINRYCGSGLEAIALATAKIKSGMADCIIAGGTESMS MVPMMGYKTALNWKIASEHPDYYLSMGLTAEELAKDYDISREDSDQFAVTSHERAISAIK EGRFKEEIVPIEVEETFVDASGKRQTRTFTVDTDEGPRPGTNMDVLGGLKPAFKQGGQVT AGNSSQTSDGAAFTVVMSERMVKELNLEPVARLVSYSVAGVDPRIMGIGPKEAVPKALKQ AGMKMSDISLVELNEAFAAQALAVIRALDMDPNTVNVNGGAVALGHPLGCTGAKLTVQMI NELRRRNQKYGMVTACVGGGQGVAGVVELLK