Protein Info for Echvi_1027 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: DNA mismatch endonuclease Vsr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF03852: Vsr" amino acids 22 to 90 (69 residues), 98.5 bits, see alignment E=1.6e-32 TIGR00632: DNA mismatch endonuclease Vsr" amino acids 24 to 135 (112 residues), 136.9 bits, see alignment E=2e-44

Best Hits

Swiss-Prot: 51% identical to VSN1_NEIMC: Putative NmeDIP very short patch repair endonuclease (vsr) from Neisseria meningitidis serogroup C

KEGG orthology group: K07458, DNA mismatch endonuclease, patch repair protein [EC: 3.1.-.-] (inferred from 58% identity to fbc:FB2170_05415)

Predicted SEED Role

"Very-short-patch mismatch repair endonuclease (G-T specific)" in subsystem DNA repair, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FW78 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Echvi_1027 DNA mismatch endonuclease Vsr (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKSYSAPKIKVPRFKEENGFYTTKQRSFMMSRIKGKDTKPEKLLKKALWHTGLHHRSNK
RKLPGKPDLTFIKYKLVIFVDGAFWHGHNWPERKQAIKSNRAFWIPKIERNIQRDHEINA
LYHQKGWTVLRFWDFEVKKELGVCVRRVLEHKSIF