Protein Info for Echvi_1008 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Fatty acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details PF00487: FA_desaturase" amino acids 65 to 338 (274 residues), 130.3 bits, see alignment E=5.5e-42

Best Hits

KEGG orthology group: None (inferred from 54% identity to zpr:ZPR_1492)

Predicted SEED Role

"Linoleoyl-CoA desaturase (EC 1.14.19.3)" (EC 1.14.19.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.19.3

Use Curated BLAST to search for 1.14.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTN8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Echvi_1008 Fatty acid desaturase (Echinicola vietnamensis KMM 6221, DSM 17526)
IKTIRFTESALSEFSITLRSRVNAYFKQSQKSRYGNLEMILKTIFMLSLYFVPVLLVILG
VVSQTWQLYVCFILSGLGMAGIGMGVMHDAIHGTYSKNKLINKLLGYTLNMVGANATVWK
IQHNVLHHSFTNIHEGDDDINVPFFLRFSPNAKKNGFHPYQHLYTWFFYGLSTLSWVTSK
DFIRLHRYYKMGLLRGKNIYRDTIVKIIAWKLLYYAFILGLPIVFSPFGVGQILLAFLAL
HFVTGLSISLVFQTAHIMPDVTFPKMDGDGQVEGERMIHQLMTTCNYSERNRVFSWMIGG
LNYQIEHHLFPDICHVHYRKIAPIVRQTAAEYQLPYYSKVTFAQALRSHFKMLHWLGNTK
VAS