Protein Info for Echvi_1004 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane receptor proteins, mostly Fe transport

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 795 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 22 to 87 (66 residues), 62.1 bits, see alignment E=1.3e-20 PF13715: CarbopepD_reg_2" amino acids 23 to 107 (85 residues), 82.4 bits, see alignment E=5e-27 PF07715: Plug" amino acids 114 to 221 (108 residues), 46.2 bits, see alignment E=1.5e-15 PF00593: TonB_dep_Rec_b-barrel" amino acids 299 to 749 (451 residues), 87.8 bits, see alignment E=3.8e-28 PF14905: OMP_b-brl_3" amino acids 564 to 753 (190 residues), 32 bits, see alignment E=1.8e-11

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 52% identity to sli:Slin_5636)

Predicted SEED Role

"Thiamin-regulated outer membrane receptor Omr1" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX92 at UniProt or InterPro

Protein Sequence (795 amino acids)

>Echvi_1004 Outer membrane receptor proteins, mostly Fe transport (Echinicola vietnamensis KMM 6221, DSM 17526)
MKTLLLIAAWLLTGICAMAQHQLTGTVKDAETGEPLIGANVILEGTGRGATADLNGTFTI
KNVPSGNYQLKVSYVGYEAHVQTVEAQSPRLEILLEPNALLTEEFIVSATRASETTPTTF
STVTKEDIAKNNLGQDIPFLLNNTPSVVTNSDAGAGIGYTGLRIRGSDQTRINVTVNGIP
LNDAESHGVFWVNMPDFASSVDNIQIQRGVGTSTNGAATFGASMNIQTDTKKEEAYGEVA
TSFGSFNSQKYTVQAGSGLLNDRWAVDARLSQIKSDGYVDRASSDLKSYFLSGGYYGDNH
VFKVNVFSGKEKTYQAWYGLPEDKLETDRTFNYYTYDNETDNYQQDHYQFIYTGKYGQNW
KAHAALHYTYGRGYYEQFREDDDYASYGLDPVVIGNETIESTDIIRRRWLDNDFFGGVFS
LNYVSDDGRWDVILGGGANRYDGDHFGEIIWARIAGETDIRDRYYDNNAVKDDRNIYAKA
TYEVADRLYLFGDLQFRQIDYRFKGINDDRRIVDGAQHYDFFNPKVGISYESGKGETWYA
SYAVANREPVRSDFTDNPITEIPRPERLHNVEAGIRAQKGNVSYSANFYYMGYKDQLILT
GQINDVGAYIRENVDNSYRAGIELDGAVKLSPKWTLGGNIAFSRNKIDTFTEYVDDYSTE
EFQQESFTYEDTDIAFSPNIVGSAMLDFHPVKNMEISWVAKYVDDQYLDNTQNDGRKLDA
FFTNDIRFAYTLRPRFLRALEFNVKVNNVFDVMYEPNGYTFSYFVPGGAGKELVTENYYY
PMAGTNFMAGVNVKF