Protein Info for Echvi_0984 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosophoadenylyl-sulfate reductase (thioredoxin)/thioredoxin-dependent adenylylsulfate APS reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00434: phosophoadenylyl-sulfate reductase
  • amino acids 26 to 231 (206 residues), 178.3 bits, E=1.9e-56
• PF01507: PAPS_reduct
  • amino acids 33 to 207 (175 residues), 157.3 bits, E=2.1e-50
• TIGR02055: adenylylsulfate reductase, thioredoxin dependent
  • amino acids 38 to 230 (193 residues), 257.3 bits, E=9.1e-81

Best Hits

Swiss-Prot: 50% identical to CYSH_BURCE: Thioredoxin-dependent 5'-adenylylsulfate reductase (cysH) from Burkholderia cepacia

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 64% identity to cpi:Cpin_2026)

MetaCyc: 55% identical to assimilatory adenylyl-sulfate reductase (Allochromatium vinosum)
Adenylyl-sulfate reductase (glutathione). [EC: 1.8.4.9]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8) / Adenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.10)" in subsystem Cysteine Biosynthesis (EC 1.8.4.10, EC 1.8.4.8)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction II (3/3 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction III (2/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• assimilatory sulfate reduction I (2/4 steps found)
• selenate reduction (2/5 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.10 or 1.8.4.8 or 1.8.4.9

Sequence Analysis Tools

See L0FX76 at UniProt or InterPro

Protein Sequence (233 amino acids)

>Echvi_0984 phosophoadenylyl-sulfate reductase (thioredoxin)/thioredoxin-dependent adenylylsulfate APS reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKKNLLKDLSTRLDNLSISEAMAQLCELFPGKVVFSTSLGQEDQVITEIIAKHNLPVKIF
TLDTGRLFYETYDLLARTESRYKIKIKPYYPNTGSVEKLVSDIGINGFYESPENRKSCCY
VRKVEPLKRALAGNSIWITGLRAEQSNNRSGMQKLEWDEGNQIMKFNPLLDWSMDEMLQY
ISDHNIPYNPLHDKGFVSIGCAPCTRAIEPGEDPRAGRWWWEASHKECGLHIK