Protein Info for Echvi_0983 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: sulfate adenylyltransferase, small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR02039: sulfate adenylyltransferase, small subunit" amino acids 11 to 299 (289 residues), 417 bits, see alignment E=2.7e-129 PF01507: PAPS_reduct" amino acids 28 to 253 (226 residues), 159.9 bits, see alignment E=3.3e-51

Best Hits

Swiss-Prot: 61% identical to CYSD_MYCVP: Sulfate adenylyltransferase subunit 2 (cysD) from Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 83% identity to fbc:FB2170_17171)

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTL2 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Echvi_0983 sulfate adenylyltransferase, small subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNTFVPNPKEAESIHIIREVAAQFEKPVLMFSGGKDSITLVRLAQKAFYPAKIPFPLLH
VDTGHNFPETIEFRDKLVEELGLELIVANVQDSIDQGKVQEERGRYSSRNSLQTTTLLDA
IEEHKFDACIGGARRDEEKARAKERVFSVRDDFGQWDEKNQRPELFDMLNGKIHHGQNVR
AFPISNWTELDVWEYIKTENIKIPSIYFAHKRETFVRDGMIWTASEHVYREDHEAVEERM
VRFRTVGDMTCTAAVLSEAETLEEVVDEIRASTISERGARIDDKRSEAAMENRKKVGYF