Protein Info for Echvi_0982 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: sulfate adenylyltransferase, large subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00231: small GTP-binding protein domain
  • amino acids 7 to 197 (191 residues), 46.8 bits, E=2.8e-16
• PF00009: GTP_EFTU
  • amino acids 7 to 210 (204 residues), 157.4 bits, E=4.9e-50
• TIGR02034: sulfate adenylyltransferase, large subunit
  • amino acids 11 to 418 (408 residues), 504 bits, E=3.4e-155
• PF22594: GTP-eEF1A_C
  • amino acids 321 to 418 (98 residues), 61 bits, E=1.9e-20

Best Hits

Swiss-Prot: 47% identical to CYSN_ALIF1: Sulfate adenylyltransferase subunit 1 (cysN) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: K00956, sulfate adenylyltransferase subunit 1 [EC: 2.7.7.4] (inferred from 66% identity to fjo:Fjoh_1503)

Predicted SEED Role

"Sulfate adenylyltransferase subunit 1 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction II (3/3 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (7/9 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction III (2/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• sulfate activation for sulfonation (1/2 steps found)
• assimilatory sulfate reduction I (2/4 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of seleno-compound metabolism (8/19 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (2/12 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Sequence Analysis Tools

See L0FW35 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Echvi_0982 sulfate adenylyltransferase, large subunit (Echinicola vietnamensis KMM 6221, DSM 17526)
MSTENRKLINIATAGSVDDGKSTLIGRLLYDTKSLTTDKLEAIERNSKQKGFDYLDFSLA
TDGLVAEREQGITIDVAHIYFNTDKTNYIIADTPGHVEYTRNMVTGASTSSAAIILIDAR
KGVIEQTYRHFFINNLLRVGHVIVAVNKMDLVDYDQQAYEDIKKDFEALIEKSNYTKDQV
RFIPVSALHGDNIAGGSDKMDWYQGPSLLDYLEGLEIDESEDNSAARFPVQYVVRPKTDA
HHDFRGFAGKLYGGKLAVGDEVTVLPSFTTSKVKSINFFDQEFDEAIPGSSITITLEDEV
NVSRGDMLVKSNELPKSEKQLSATICQVNSKPLRTGAKYILQHGVNQVLAKVDSIEGLVH
TDFSGSEGTDELKLNDIGKVNFRLSKPIHFDPYQESKSNGSFILIDEGSYDTTSVGFIQ