Protein Info for Echvi_0965 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: GAF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01590: GAF
  • amino acids 33 to 156 (124 residues), 24.5 bits, E=3.5e-09
• PF13185: GAF_2
  • amino acids 37 to 156 (120 residues), 36 bits, E=7.5e-13

Best Hits

Swiss-Prot: 59% identical to GAFA_DICDI: GAF domain-containing protein A (gafA) from Dictyostelium discoideum

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 68% identity to mtt:Ftrac_1491)

MetaCyc: 48% identical to free methionine-(R)-sulfoxide reductase (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]

Predicted SEED Role

"GAF domain-containing protein, involved in signal transduction"

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.14

Sequence Analysis Tools

See L0FWV0 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Echvi_0965 GAF domain-containing protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MAESIFLPEAATKAEKYEALLPQLEALTTGESDLTANLANISAALKEAFGFFWVGFYLVK
DAQLVLGPFQGPIACTRIQYGKGVCGAAWKEGKTQLVPDVDAFPGHIACSSASKSEIVLP
ALKNDKVALVLDIDSDQLNDFDDTDAAHLEKLMRVIERFL