Protein Info for Echvi_0964 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: riboflavin biosynthesis protein RibD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00383: dCMP_cyt_deam_1" amino acids 3 to 104 (102 residues), 61.5 bits, see alignment E=9.3e-21 TIGR00326: riboflavin biosynthesis protein RibD" amino acids 10 to 323 (314 residues), 301.3 bits, see alignment E=4.7e-94 PF14437: MafB19-deam" amino acids 27 to 110 (84 residues), 29.2 bits, see alignment E=1.1e-10 PF01872: RibD_C" amino acids 152 to 307 (156 residues), 118.5 bits, see alignment E=5.4e-38

Best Hits

KEGG orthology group: K11752, diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC: 1.1.1.193 3.5.4.26] (inferred from 52% identity to chu:CHU_0203)

Predicted SEED Role

"Diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) / 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)" in subsystem Riboflavin, FMN and FAD metabolism (EC 1.1.1.193, EC 3.5.4.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.193 or 3.5.4.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FX59 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Echvi_0964 riboflavin biosynthesis protein RibD (Echinicola vietnamensis KMM 6221, DSM 17526)
MAMTADEKYMLRALELAELGRGHVSPNPMVGCVIVYGDRIIGEGYHMQYGGPHAEPNAVN
SVTDPTLLREATVYVTLEPCAHFGKTPPCANLLAEKQVKKVVIAAVDSNPLVGGKGIKIL
EEAGIEVVTGIQEQASRKLNKRFFTAIEKNRPYVILKWAQTQDGYIARSNYDSKWISNSY
SRQLVHKWRTEEDAIMVGTKTAYFDDPRLNVRDWQGKDPLRIVLDKQLTLDKNLHLFDQR
IPTICYNLIKDESAHHLTYVKLKEHFGIDDILKDLHQRKVQSVIIEGGSYLLQKFIQSEL
WDEARVFTGQSTFENGISAPKLNQQASETLDIMGDRLEIFERNTSSS