Protein Info for Echvi_0908 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Beta-xylosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 611 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF04616: Glyco_hydro_43" amino acids 58 to 329 (272 residues), 91.3 bits, see alignment E=1.5e-29 PF00754: F5_F8_type_C" amino acids 402 to 513 (112 residues), 41.5 bits, see alignment E=2.9e-14 PF22633: F5_F8_type_C_2" amino acids 403 to 498 (96 residues), 38.4 bits, see alignment E=3.1e-13 PF00041: fn3" amino acids 527 to 610 (84 residues), 27.6 bits, see alignment E=5.4e-10

Best Hits

KEGG orthology group: None (inferred from 46% identity to gfo:GFO_0366)

Predicted SEED Role

"Arabinan endo-1,5-alpha-L-arabinosidase A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWQ0 at UniProt or InterPro

Protein Sequence (611 amino acids)

>Echvi_0908 Beta-xylosidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MHRILLLTLTLGILSACSPESTKEETKETPSSTAKRSFTTYCNPLDIDYTYMSHYRARNN
VSYRSGADPAIVNFKGKYYLFVTRSHGYWVSDDMSNWRFIRPQSWYFNGSNAPAAAVKDG
KIILLGDPSGRGAVIETDNPDLGDWKTNFAVINVPGGVQDPNLFVDDDGKVYLYEESSNK
WPIHGIELDADNYFIPKGEQVDLFNLEPEKHGWERFGQDHKSDLKPFIEGPWMVKHNGKY
YLEYGAPGTQWNVYADGVYTSDSPLGPFTYAPYNPISYKPGGFLKGSGHGSTVKDNHGNH
WHFATMAISVNYKFERRIGMYPAGFEENGQMYVNTAYGDYPHYLPDTDVEDHKHRFTGWM
LLSYNKPVTTNSPEVNMDLNVVDESEGGYMQEQIREFDISQINDEEIRSYWVSEANHDSI
YVELDLEKPMDVKAIQINFQDFNSEIFGRPDTLRQQFVIKTSMDGKRWETVADYSKNQRD
MPHGYIELDQAVEARYVRYEHVYCTNKFLAISELRVFGNGKEALPETPSNFVAQRQNDRR
NTNLSWDPVEGATGYVIYWGIHKDKLNLSALMYGQHEYELRALNTDQRYYYQVEAFDENG
ISQKSEILFTE