Protein Info for Echvi_0906 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ferrous iron transporter FeoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 transmembrane" amino acids 287 to 308 (22 residues), see Phobius details amino acids 318 to 335 (18 residues), see Phobius details amino acids 343 to 367 (25 residues), see Phobius details amino acids 387 to 410 (24 residues), see Phobius details amino acids 421 to 447 (27 residues), see Phobius details amino acids 459 to 480 (22 residues), see Phobius details amino acids 518 to 537 (20 residues), see Phobius details amino acids 651 to 677 (27 residues), see Phobius details amino acids 688 to 709 (22 residues), see Phobius details TIGR00231: small GTP-binding protein domain" amino acids 12 to 172 (161 residues), 48.7 bits, see alignment E=7e-17 PF02421: FeoB_N" amino acids 14 to 170 (157 residues), 184.7 bits, see alignment E=1.7e-58 PF01926: MMR_HSR1" amino acids 14 to 129 (116 residues), 71.4 bits, see alignment E=1.4e-23 TIGR00437: ferrous iron transport protein B" amino acids 19 to 680 (662 residues), 537.4 bits, see alignment E=5.2e-165 PF07670: Gate" amino acids 351 to 445 (95 residues), 87.2 bits, see alignment E=1.9e-28 amino acids 520 to 682 (163 residues), 65.3 bits, see alignment E=1.2e-21 PF07664: FeoB_C" amino acids 462 to 514 (53 residues), 54 bits, see alignment 2.3e-18

Best Hits

Predicted SEED Role

"Ferrous iron transport protein B" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FTE1 at UniProt or InterPro

Protein Sequence (710 amino acids)

>Echvi_0906 ferrous iron transporter FeoB (Echinicola vietnamensis KMM 6221, DSM 17526)
MPEVITPEKLSTFTVALIGNPNVGKTTIFNRLTGLRQKVGNYPGVTVDKRYASVKLGDQQ
ATIIDLPGTYSIYPNSEDEVIVHRVLNGLDKSSKPDFVLAVVDMSSMERGLFLVTQIMDL
GLPMAVVLNMADTAEEQGIKVKAHALYKALGVPVIQTNARSNKGINGILDLIGQQMFEKP
TSFLDSDKLLPAELSANVREKFTLNNTYQAYQLIRFHNNEPILSQEDHDWLHEQVTQADF
DLKATQIKETQERYAAIQQVLEQSVEKTDIQKKRLTDQLDKLFLHKIGGYAIFLCILLLI
FQAVFAWSAVPMDLIDGFFARLSGTVAGWLPEGVLTDLITEGIIPGIGGVVIFIPQIALL
FAFLGILEDTGYMSRVVFLMDRIMRPFGLNGKSVVPLISGIACAIPGIMASRNIGNWKDR
LITIMVTPLMSCSARLPVYVILIGIAVPATNVGPFGLQALVMLGMYLLGVVAVLVTAWIL
KMVLHFKERSYLMVEMPMYRLPRWKDVLITMYSKSKTFVFEAGKVILAISIVLWVLASYG
PSSAREEAIAAVEVPADGASEEAMLDYRHNLESAELESSYIGIAGQFIEPAIRPLGYDWK
IGIALITSFAAREVFVSTMATLYSVGSEVEDELTIQQKLKSEVNPNTGEAVFNLATAISL
MVFYAFAMQCMSTLAVVYRETKGWKWPVIQTVYMTALAYVSALIAYQLFS