Protein Info for Echvi_0904 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 118 to 144 (27 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 9 to 277 (269 residues), 128.2 bits, see alignment E=2.3e-41 TIGR00374: TIGR00374 family protein" amino acids 16 to 145 (130 residues), 63.6 bits, see alignment E=1e-21 amino acids 191 to 271 (81 residues), 46.7 bits, see alignment E=1.5e-16

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 43% identity to rbi:RB2501_11557)

Predicted SEED Role

"FIG00495792: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV42 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Echvi_0904 conserved hypothetical protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MPKKTLKLLLKVLLTGVAIYLVFRKIDLEATWQVIKKANLAFLVIAALCFVLSKILSSFR
LNGLFRNLDVRLSERQNLKLYWIGMFYNLFLPGGIGGDGYKVYWLNKRFDAKVKKLLAAV
LLDRVSGLIALVWLLLVIWFFVTVEWTAPWGINLDLIAAAGLCLVPLAFVGVIRWWFPSF
WASTALTGGYSLLVQSAQLICAYFILLGLGVQTQILEYQFVFLLSSIVAVLPLTIGGVGA
RELVFIFSHEYMGIDKNVAVAFSLLFFLITALVSLAGATVKMEPGTAISEQ