Protein Info for Echvi_0903 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferases involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 226 to 241 (16 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 282 to 308 (27 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 22 to 144 (123 residues), 32.4 bits, see alignment E=1e-11 PF00535: Glycos_transf_2" amino acids 23 to 171 (149 residues), 111.4 bits, see alignment E=4.7e-36

Best Hits

Swiss-Prot: 49% identical to RGTE_RHIL3: Dodecaprenyl-phosphate galacturonate synthase (rgtE) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: None (inferred from 64% identity to nis:NIS_1112)

Predicted SEED Role

"Glycosyl transferase, family 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWP5 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Echvi_0903 Glycosyltransferases involved in cell wall biogenesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MVSVQKSCNFDQILYGMSQLQLSLVVTVYNEEENIQPLLAAVYEALEGISYELILVDDGS
TDKTVAMAKQHANTATRVLIFNKNYGQTTALAAGIDHATGAYIVTMDGDLQNDPSDIPMM
LQKAIDEDWDVVAGVRANRQDGFVLRKLPSKFANWMIRNTTKVYLKDYGCSLRVYKANIA
QNMGLYGELHRFIPVLAKQEGARMTEVNVKHHPRIHGTSKYGLNRTFKVLADLILMLFFQ
KYLQRPIHIFGGLGLLALISGVLINFYLLVLKILGEDIWGRPILLVGLILVLGGLQLITT
GIVAEIIVRTYFESQNKKTYTIKEVFQGA