Protein Info for Echvi_0884 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphoribosylaminoimidazole carboxylase, PurK protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF22660: RS_preATP-grasp-like" amino acids 8 to 105 (98 residues), 112.5 bits, see alignment E=2.2e-36 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 9 to 365 (357 residues), 381.2 bits, see alignment E=2.9e-118 PF02222: ATP-grasp" amino acids 112 to 285 (174 residues), 151 bits, see alignment E=5.6e-48 PF17769: PurK_C" amino acids 306 to 366 (61 residues), 67.3 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 62% identity to chu:CHU_3733)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV26 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Echvi_0884 phosphoribosylaminoimidazole carboxylase, PurK protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MQDNYQQKTLGIVGGGQLGRMVIQSAINYNIDIHILDPDENAPCKHICHDFSQGKLTDYD
TVYAFGKKCDVITIEIENVNTEALEQLAKEGKKVFPQPEIIRLIQDKREQKQFYKEHNIP
TADFVLTDTKEDVLSQADFLPAVNKLGKEGYDGRGVQILKTPADLEKAFEAPSLLEKLID
FDKEIAVIVSRNEQGELVAFPPVECAFHPTANLVEFLFAPAQISDAISQASIEVAKEVIT
KLDMIGILAVEMFVTKSGEILVNEIAPRPHNSGHHTIEANFTSQFEQHLRSVMGMPLGNT
GLRTPAAMVNLLGEDGFTGEAVVEGMDEAMKEKGVYLHLYGKKITKPFRKMGHVTILEAN
VEALKAKALKIKNSIKIKA