Protein Info for Echvi_0880 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Outer membrane protein/protective antigen OMA87

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01103: Omp85" amino acids 85 to 359 (275 residues), 44.3 bits, see alignment E=8.9e-16

Best Hits

KEGG orthology group: None (inferred from 68% identity to fjo:Fjoh_3342)

Predicted SEED Role

"Outer membrane protein/protective antigen OMA87"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVU9 at UniProt or InterPro

Protein Sequence (359 amino acids)

>Echvi_0880 Outer membrane protein/protective antigen OMA87 (Echinicola vietnamensis KMM 6221, DSM 17526)
MKNFKFLLPAIILVFSVCQVNGQDTTDSTATQEAHAKKVDFSLMPFLSYNRNLELMFGVI
PMMMYKLDPSDSISPKSLSGLSAIYTTNGSYFIAGFNRWYLKEDQWRISLFGLTGDNNSQ
FFMDDVDTPGFYDYGTKTTIVSVGVQRQIVKAFYGGITYTFSHYDTQYEDNVQPPSTTRT
NGLEVNLLLDTRDAVYYPTTGKRSRLRWITYPEGVGNEVSANKILSEYNQYFSMRDDQDV
LAARFSGKFGLGDIAFEQQVTVGGKDIRGYSQGKYRGDGLMAFQGEYRYNLNEKMGLVGF
AGMATIYGSDTDSFNWKLYPGAGVGYRYRAFKTVKFNIGLDAAVGKDDWGVYFRIGEAF