Protein Info for Echvi_0874 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF08818: DUF1801" amino acids 15 to 118 (104 residues), 77.9 bits, see alignment E=6.5e-26 PF13376: OmdA" amino acids 134 to 191 (58 residues), 67.7 bits, see alignment E=6.8e-23

Best Hits

Swiss-Prot: 61% identical to YDEI_BACSU: Uncharacterized protein YdeI (ydeI) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 62% identity to shg:Sph21_0960)

Predicted SEED Role

"DUF1801 domain-containing protein" in subsystem Experimental tye

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV18 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Echvi_0874 Uncharacterized protein conserved in bacteria (Echinicola vietnamensis KMM 6221, DSM 17526)
MNPKVDFFFEKDSKWQEAYGHLRKLVLECGLTETLKWGVPCYTYPSGKTGKPANVVLIHG
FKEYCALLFHKGALLKDTDSLLIQQTENVQAARQIRFTSTQEISDNLPVLKAYIYQAIEV
EKAGLEVKLKKTKEFDMPEEFKEYLDQNPDLKKAFEHLTPGRQRGYLLHFAQPKQSKTKV
SRIEKAIPRIFDGLGLND