Protein Info for Echvi_0872 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF02746: MR_MLE_N" amino acids 11 to 115 (105 residues), 25.2 bits, see alignment E=1.6e-09 PF13378: MR_MLE_C" amino acids 140 to 335 (196 residues), 114.8 bits, see alignment E=4.8e-37

Best Hits

Swiss-Prot: 56% identical to AXEP_FLAJ1: L-Ala-D/L-amino acid epimerase (Fjoh_2168) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: None (inferred from 61% identity to dfe:Dfer_3890)

Predicted SEED Role

"Muconate cycloisomerase (EC 5.5.1.1)" in subsystem Catechol branch of beta-ketoadipate pathway or Muconate lactonizing enzyme family (EC 5.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWX5 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Echvi_0872 L-alanine-DL-glutamate epimerase and related enzymes of enolase superfamily (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLEILIKQLPLKHTFTIAHQSRDVQETLIVRLTDGEHYGLGESTTNPFYGMTVENMTAA
LENARPIVEAGNWDTPEALWEECKTIFADNPFAQCALDLAAWDLFTKKLDVKLYEYLKLD
PLNIPTTNFTIGIADTAKMVEKMKELDWPLYKIKLGTDHDLEIVRELRKHTKAIFRIDAN
CAWNAEQAITYSHELKKLQVEFMEQPLAKDDLEGMKEVYQHSKLPVIADESCIVEADVKK
CHGYFHGINVKLVKAGGITPGLRMLYEAKSLGMQTMVGCMTESSVGVTAIAHIAPLLDYV
DMDGAMLLAKDIAKGVHIEPGKVTFPEGPGIGAELI