Protein Info for Echvi_0870 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00977: His_biosynth" amino acids 3 to 233 (231 residues), 193 bits, see alignment E=2.6e-61

Best Hits

Swiss-Prot: 46% identical to HIS4_BACTN: 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (hisA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01814, phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC: 5.3.1.16] (inferred from 46% identity to bth:BT_1379)

MetaCyc: 31% identical to 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (Escherichia coli K-12 substr. MG1655)
isomerase. [EC: 5.3.1.16]

Predicted SEED Role

"Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase (EC 5.3.1.16)" in subsystem Histidine Biosynthesis (EC 5.3.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.16

Use Curated BLAST to search for 5.3.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVU4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Echvi_0870 Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MFEIIPSIWIINGKCVRLKKGDFTTEQVISDNPLEIAQEFENCGIERIHLVDLDGARRGS
PKNYHILHTISAYTSLIVDFTGGVGTDGDIIKVFEHGAKTITAATVAANSPEKFSQWLIS
YGREKINMAADTDPKDHLIKIKGWQKNTDIHLYDQISYFYDRGLKYLKCSDITREGVMEG
PNFKLYEEIIARFPNLHLVASGGVRNVDDFKRLKELGLRGVVFGKAYYSGNITAEELKTF
VASCKAPI