Protein Info for Echvi_0865 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 23 to 186 (164 residues), 96.3 bits, see alignment E=7.8e-32 PF04542: Sigma70_r2" amino acids 27 to 96 (70 residues), 52.8 bits, see alignment E=4.2e-18 PF08281: Sigma70_r4_2" amino acids 131 to 170 (40 residues), 42.5 bits, see alignment 6.3e-15 PF04545: Sigma70_r4" amino acids 136 to 184 (49 residues), 37 bits, see alignment E=2.9e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 68% identity to mtt:Ftrac_2180)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FVT9 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Echvi_0865 RNA polymerase sigma factor, sigma-70 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKRLRPKDSELIAQYRNGSEAAFEVLVDKYKSRVFTTIYMIVKDQGLAEDLLQDVFVKV
IQTLNSDRYNEEGKFQPWLMRIAHNLAVDYFRKMKRYPFIMMEDGSNLFNTLKFADSNVE
DQQVKDETHALVRDLIDELPESQKQVLIMRHYMDLSFQEIADQTGVSINTALGRMRYALI
NMRKKLKQINVAYDKIFYPK