Protein Info for Echvi_0849 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: probable S-adenosylmethionine-dependent methyltransferase, YraL family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00590: TP_methylase" amino acids 8 to 207 (200 residues), 114.3 bits, see alignment E=4.1e-37 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 9 to 227 (219 residues), 269.5 bits, see alignment E=1.7e-84

Best Hits

Swiss-Prot: 52% identical to RSMI_XYLFT: Ribosomal RNA small subunit methyltransferase I (rsmI) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K07056, (no description) (inferred from 72% identity to dfe:Dfer_4999)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FV00 at UniProt or InterPro

Protein Sequence (228 amino acids)

>Echvi_0849 probable S-adenosylmethionine-dependent methyltransferase, YraL family (Echinicola vietnamensis KMM 6221, DSM 17526)
MTEEIKPHLYLVPTPIGNLQDITLRAIDVLQRVDVILAEDTRTTGKLLKHLEIQRPLQSY
HIFNEHKTVEKLVARMEAGEQFALVSDAGTPAISDPGFLLVRAVREAGLEVNCLPGATAF
VPALVNSALPNDRFVFEGFLPHKKGRKTRIENLLEEQRTMIFYESPHRLLKTLTQLMEAF
GGDRMACVSRELTKMYEENIRGTLEELIDYYNENTIKGEIVITVAGKN