Protein Info for Echvi_0844 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01676: Metalloenzyme
  • amino acids 1 to 488 (488 residues), 260.1 bits, E=2.2e-81
• TIGR01307: phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
  • amino acids 1 to 499 (499 residues), 677.6 bits, E=4.8e-208
• PF06415: iPGM_N
  • amino acids 74 to 288 (215 residues), 292 bits, E=2.6e-91

Best Hits

Swiss-Prot: 65% identical to GPMI_FLAJ1: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (gpmI) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 72% identity to mtt:Ftrac_2141)

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• Rubisco shunt (9/10 steps found)
• gluconeogenesis I (11/13 steps found)
• homolactic fermentation (10/12 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (13/17 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• glycerol degradation to butanol (12/16 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (19/26 steps found)
• Bifidobacterium shunt (11/15 steps found)
• ethene biosynthesis V (engineered) (18/25 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (17/26 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)
• photorespiration II (4/10 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

See L0FUZ6 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Echvi_0844 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Echinicola vietnamensis KMM 6221, DSM 17526)
MILDGWGLATNPEVSAIDKANTPFIDSLFEKYPHSKLDASGLAVGLPDGQMGNSEVGHMN
IGAGRVVYQDLVKINKAVEEGDLKENPILKKAFATAKESQKKVHFIGLVSDGGVHAHIKH
LKGLCDAAKANGITEPYIHAFTDGRDTDPKSGLGYLEDLQQHCSQSVGKIASVIGRYYAM
DRDKRWERVKLAYDAMVLGEGEKSKDILAAIKKSYTNGVTDEFIRPIVQVDENGKAIATI
EEGDVVICFNFRTDRGREITQVLTQQDFEDYKMKKLDLHYVTFTNYDETFNGVSVIFEKD
NLKNTLGEVLANNDKKQIRIAETEKYPHVTFFFSGGRESEFDGESRILCSSPKVATYDLQ
PEMSAYEIAKKINVELDKKETDFVCLNFANADMVGHTGVFEAAVKACEAVDECTNSVIST
ALKNDYSVIVIADHGNSDKMLNEDGTPNTAHTTNLVPCIMVDKKDQLEVNDGKLGDLAPT
ILKMMGVDIPAEMTGDVLLK