Protein Info for Echvi_0841 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: aspartyl-tRNA synthetase, bacterial type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 TIGR00459: aspartate--tRNA ligase" amino acids 2 to 583 (582 residues), 734.2 bits, see alignment E=4.9e-225 PF01336: tRNA_anti-codon" amino acids 19 to 103 (85 residues), 40.5 bits, see alignment E=3.2e-14 PF00152: tRNA-synt_2" amino acids 121 to 554 (434 residues), 407.3 bits, see alignment E=5.9e-126 PF02938: GAD" amino acids 314 to 400 (87 residues), 49.8 bits, see alignment E=4.9e-17

Best Hits

Swiss-Prot: 72% identical to SYD_CYTH3: Aspartate--tRNA ligase (aspS) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01876, aspartyl-tRNA synthetase [EC: 6.1.1.12] (inferred from 76% identity to mtt:Ftrac_2962)

Predicted SEED Role

"Aspartyl-tRNA synthetase (EC 6.1.1.12)" in subsystem tRNA aminoacylation, Asp and Asn (EC 6.1.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT83 at UniProt or InterPro

Protein Sequence (584 amino acids)

>Echvi_0841 aspartyl-tRNA synthetase, bacterial type (Echinicola vietnamensis KMM 6221, DSM 17526)
MLRTHTCGELRIGDVGEEVTLSGWVQRVRNKGGLVWVDLRDRYGVTQLIFEEGSSDQALL
EKAASLGREFVIQAAGEVIERTSKNNKIPTGDIEVKTTALKVLNAAKVPPFVIEDETDGG
EDLRMKYRYLDLRRRVVREKLQLRHRMMQETRKFMDGLDFMEVETPVLIKSTPEGARDFL
VPSRINEGEFYALPQSPQTFKQLLMVSGFDRYFQIVKCFRDEDLRADRQPEFTQIDCEMS
FVEQEDILTTFEGLVRHLFSTVKKVELGEVERMTFADAMKYYGNDKPDLRFDMKFVELND
VAQNKGFKIFDEAELVVGIAAPGAASYTRKQVDALTEWVKRPQIGAKGLVYVKCNDDGTF
KSSVDKFYSQEDLKAWADKMNAQPGDLILVLSGDQNATRKQLSELRLKMGSDLGLRDKNT
FKPLWVLDFPLLEWDEDTKRFHAMHHPFTSPKQEDIPLLENDPGAVRANAYDLVINGVEI
GGGSIRIHDRDTQKTMFKHLGFSDEEAQAQFGFLMEAFEYGAPPHGGIAFGFDRLCAIFG
GSDSIRDYIAFPKNNSGRDVMIDSPSAIADEQLKELSIQLALKK