Protein Info for Echvi_0837 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 transmembrane" amino acids 195 to 215 (21 residues), see Phobius details TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 43 to 204 (162 residues), 65.3 bits, see alignment E=2.7e-22 PF07638: Sigma70_ECF" amino acids 123 to 195 (73 residues), 23.7 bits, see alignment E=5.9e-09 PF08281: Sigma70_r4_2" amino acids 149 to 202 (54 residues), 42.7 bits, see alignment E=5.2e-15 PF04545: Sigma70_r4" amino acids 154 to 204 (51 residues), 34.2 bits, see alignment E=2.3e-12

Best Hits

KEGG orthology group: None (inferred from 35% identity to sli:Slin_3388)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FWU5 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Echvi_0837 RNA polymerase sigma factor, sigma-70 family (Echinicola vietnamensis KMM 6221, DSM 17526)
MSLLHERSIKPKTATSSAPAADGFGVGMEESRLWDAFRTGNEEAFITIYKQYANVLFNFG
CQLTMDHDLVKDTLQDFFIYLRHKRNGLGKTDAIKPYLFKSFKRRIIDAVKKHHHRFSSH
HAFDFKQFPVELSHETVYINRQMEREQLEKLTMALQQLDTREREAIYYFYFEGLSYQEIA
QIFEFSHISSARRLVYRGLAHLRKFFVAYLLAAFWELKEW